Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Glp1r protein

This Rat Glp1r protein spans the amino acid sequence from region 22-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glpr

UniProt

P32301

Expression Region

22-145aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-147AA: 22-145AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mid1 3'UTR GFP Stable Cell Line
TU163196 1.0 mL

Mid1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ANKRD22 CRISPR Activation Plasmid (m)
sc-424577-ACT 20 µg

ANKRD22 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
TMEM42 CytoSection
TS405777P5 25 Slides

TMEM42 CytoSection

Sign In for Pricing
View Details
Fam64a 3'UTR Lenti-reporter-Luc Vector
20075086 1.0 µg

Fam64a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CDH1 (Cadherin 1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO, E-Cad/CTF3, Uvomorulin, E-Cadherin) (MaxLight 550)
MBS6410762-01 0.1 mL

CDH1 (Cadherin 1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO, E-Cad/CTF3, Uvomorulin, E-Cadherin) (MaxLight 550)

Sign In for Pricing
View Details
CDH1 (Cadherin 1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO, E-Cad/CTF3, Uvomorulin, E-Cadherin) (MaxLight 550)
MBS6410762-02 5x 0.1 mL

CDH1 (Cadherin 1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO, E-Cad/CTF3, Uvomorulin, E-Cadherin) (MaxLight 550)

Sign In for Pricing
View Details