Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Glp1r protein

This Rat Glp1r protein spans the amino acid sequence from region 22-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glpr

UniProt

P32301

Expression Region

22-145aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-147AA: 22-145AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pik3cd ORF Vector (Mouse) (pORF)
ORF054052 1.0 µg DNA

Pik3cd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Histone H3K9me1 Antibody
MBS7133591-01 0.1 mL

Histone H3K9me1 Antibody

Sign In for Pricing
View Details
Histone H3K9me1 Antibody
MBS7133591-02 5x 0.1 mL

Histone H3K9me1 Antibody

Sign In for Pricing
View Details
Putative Protein-Lysine Deacylase ABHD14B (ABHD14B) Antibody
abx037977-01 100 µg

Putative Protein-Lysine Deacylase ABHD14B (ABHD14B) Antibody

Sign In for Pricing
View Details
Putative Protein-Lysine Deacylase ABHD14B (ABHD14B) Antibody
abx037977-02 1 mg

Putative Protein-Lysine Deacylase ABHD14B (ABHD14B) Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD161/NK1.1 Antibody (PK136)
PE-30029U-01 25 µg

PE Anti-Mouse CD161/NK1.1 Antibody (PK136)

Sign In for Pricing
View Details