What is the catalog number for Mouse Sdf2 protein?

The catalog number for Mouse Sdf2 protein is orb54190.

What sizes are available for Mouse Sdf2 protein?

Mouse Sdf2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Mouse Sdf2 protein come in?

Mouse Sdf2 protein is available in 3 different pack sizes.

Is Mouse Sdf2 protein in stock?

Mouse Sdf2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse Sdf2 protein

This Mouse Sdf2 protein spans the amino acid sequence from region 19-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sdf2, Stromal cell-derived factor 2, SDF-2

UniProt

Q9DCT5

Expression Region

19-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged23-464AA: 19-211AAFull Length of Mature Protein: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL