Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sdf2 protein

This Mouse Sdf2 protein spans the amino acid sequence from region 19-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sdf2, Stromal cell-derived factor 2, SDF-2

UniProt

Q9DCT5

Expression Region

19-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged23-464AA: 19-211AAFull Length of Mature Protein: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse BC061195 activation kit by CRISPRa
GA208148 1 Kit

Mouse BC061195 activation kit by CRISPRa

Sign In for Pricing
View Details
H-DL-Leu-OBzl TosOH
sc-285927A 100 g

H-DL-Leu-OBzl TosOH

Sign In for Pricing
View Details
PEX13 Rabbit Polyclonal Antibody
TA358627 100 µL

PEX13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-01 48 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-02 96 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-03 5x 96 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details