Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial lasA protein

This Bacterial lasA protein spans the amino acid sequence from region 237-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Staphylolytic protease

UniProt

P14789

Expression Region

237-418aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged: N-terminal 6xHis-SUMO-tagged1-76AA: 237-418AAFull Length: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZUFSP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
51991066 1.0 µg DNA

ZUFSP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Amer3 shRNA (UAS) - Lentiviral mouse Amer3 shRNA (UAS) plasmid
GTR15267031 1 Vial

Lentiviral mouse Amer3 shRNA (UAS) - Lentiviral mouse Amer3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550) discontinued
043087-ML550 100 µL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Chicken Disco-Interacting Protein 2 Homolog A (DIP2A) ELISA Kit
MBS9367009 Inquire

Chicken Disco-Interacting Protein 2 Homolog A (DIP2A) ELISA Kit

Sign In for Pricing
View Details
RET-IN-23
BUP13996-01 1 mg

RET-IN-23

Sign In for Pricing
View Details
RET-IN-23
BUP13996-02 5 mg

RET-IN-23

Sign In for Pricing
View Details