Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Erap1 protein

This Mouse Erap1 protein spans the amino acid sequence from region 731-930aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARTS-1 Adipocyte-derived leucine aminopeptidase

UniProt

Q9EQH2

Expression Region

731-930aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged2228-2474AA: 731-930AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSIP2 Rabbit Polyclonal Antibody (BF647)
orb2502271 100 µL

FSIP2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Human XPNPEP2 Protein Lysate 20ug
IHUXPNPEP2PLLY20UG 20 µg

Human XPNPEP2 Protein Lysate 20ug

Sign In for Pricing
View Details
Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) APC
MBS6371971-01 0.1 mL

Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) APC

Sign In for Pricing
View Details
Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) APC
MBS6371971-02 5x 0.1 mL

Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) APC

Sign In for Pricing
View Details
Streptovitacin A
orb1701553-01 25 mg

Streptovitacin A

Sign In for Pricing
View Details
Streptovitacin A
orb1701553-02 50 mg

Streptovitacin A

Sign In for Pricing
View Details