Viral Non-structural polyprotein protein
This Viral Non-structural polyprotein protein spans the amino acid sequence from region 2228-2474aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Polyprotein nsP1234
UniProt
Q8JUX6
Expression Region
2228-2474aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Chikungunya virus (strain S27-African prototype) (CHIKV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged1-35AA: 2228-2474AAFull Length: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2034888-01 0.1 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details MBS2034888-02 0.2 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details MBS2034888-03 0.5 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details MBS2034888-04 1 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details MBS2034888-05 5 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details MBS2034888-06 5x 5 mL
APC-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
Sign In for Pricing
View Details