Insect Mexican scorpion Beta-mammal toxin Css4 protein
This Insect Mexican scorpion Beta-mammal toxin Css4 protein spans the amino acid sequence from region 20-85aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Css IV
UniProt
P60266
Expression Region
20-85aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Centruroides suffusus suffusus (Mexican scorpion)
Field of Research
Infectious Disease & Virology; Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
9.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-tagged: N-terminal 6xHis-tagged21-95AA: 1-66AAFull Length of Mature Protein: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
21510982-2 25 mg
Succinylated Concanavalin A Lectin (Succ Con A) - Pure
Sign In for Pricing
View Details EP703 100 mL
Reagecon Standard Colour Solution B (Brown) according to European Pharmacopoeia (EP) Chapter 2.2.2
Sign In for Pricing
View Details DZ41444-Biotin 200 µL/Vial
Anti-African malaria mosquito Spz3 Antibody (Biotine Conjugate)
Sign In for Pricing
View Details 
M4692-85-ML550 100 µL
MTBP (MDM2-Binding Protein, Murine Double Minute-2 BP) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
bsm-52206R-BF594 100 µL
Phospho-SMAD5 (Ser463 + Ser465) Recombinant Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details