Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Mexican scorpion Beta-mammal toxin Css4 protein

This Insect Mexican scorpion Beta-mammal toxin Css4 protein spans the amino acid sequence from region 20-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Css IV

UniProt

P60266

Expression Region

20-85aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Centruroides suffusus suffusus (Mexican scorpion)

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged21-95AA: 1-66AAFull Length of Mature Protein: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GTF2IRD1 Antibody [PerCP]
NB100-61055PCP 0.1 mL

Rabbit Polyclonal GTF2IRD1 Antibody [PerCP]

Sign In for Pricing
View Details
PRDX5 Recombinant Protein
OPCD06385-50UG 50 µg

PRDX5 Recombinant Protein

Sign In for Pricing
View Details
Bovine Angiopoietin 2, ANG-2 ELISA Kit
MBS165909-01 48 Well

Bovine Angiopoietin 2, ANG-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiopoietin 2, ANG-2 ELISA Kit
MBS165909-02 96 Well

Bovine Angiopoietin 2, ANG-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiopoietin 2, ANG-2 ELISA Kit
MBS165909-03 5x 96 Well

Bovine Angiopoietin 2, ANG-2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiopoietin 2, ANG-2 ELISA Kit
MBS165909-04 10x 96 Well

Bovine Angiopoietin 2, ANG-2 ELISA Kit

Sign In for Pricing
View Details