Human PSCA protein
This Human PSCA protein spans the amino acid sequence from region 21-95aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PSCA, UNQ206/PRO232, Prostate stem cell antigen
UniProt
O43653
Expression Region
21-95aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Disease Biomarkers
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
9.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6XHis-tagged: N-terminal 6xHis-tagged1-735AA: 21-95AAFull Length: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6493337-01 0.1 mL
Phosphorylase Kinase Subunit gamma 2, NT (PHKG2, Phosphorylase B Kinase gamma Catalytic Chain Testis/liver Isoform, PHK-gamma-T, GSD9C, PSK-C3) (MaxLight 405)
Sign In for Pricing
View Details MBS6493337-02 5x 0.1 mL
Phosphorylase Kinase Subunit gamma 2, NT (PHKG2, Phosphorylase B Kinase gamma Catalytic Chain Testis/liver Isoform, PHK-gamma-T, GSD9C, PSK-C3) (MaxLight 405)
Sign In for Pricing
View Details 
BIOBGBMPC0250S005 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE
3D 250 L Single-Use Storage Bag
Sign In for Pricing
View Details