Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSCA protein

This Human PSCA protein spans the amino acid sequence from region 21-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSCA, UNQ206/PRO232, Prostate stem cell antigen

UniProt

O43653

Expression Region

21-95aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6XHis-tagged: N-terminal 6xHis-tagged1-735AA: 21-95AAFull Length: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-FKHRL1/FOXO3A (Thr32)
B2024254 100 µL

Anti-Phospho-FKHRL1/FOXO3A (Thr32)

Sign In for Pricing
View Details
Benzyl isothiocyanate
MBS3842325-01 100 mg

Benzyl isothiocyanate

Sign In for Pricing
View Details
Benzyl isothiocyanate
MBS3842325-02 500 mg

Benzyl isothiocyanate

Sign In for Pricing
View Details
Benzyl isothiocyanate
MBS3842325-03 5x 500 mg

Benzyl isothiocyanate

Sign In for Pricing
View Details
KCNJ2 antibody
70R-18081 50 μL

KCNJ2 antibody

Sign In for Pricing
View Details
Mmu-miR-23b-3p miRNA Agomir
CMN0005-01 5 nmol

Mmu-miR-23b-3p miRNA Agomir

Sign In for Pricing
View Details