Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSCA protein

This Human PSCA protein spans the amino acid sequence from region 21-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSCA, UNQ206/PRO232, Prostate stem cell antigen

UniProt

O43653

Expression Region

21-95aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6XHis-tagged: N-terminal 6xHis-tagged1-735AA: 21-95AAFull Length: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostatic Acid Phosphatase (PAP, Acid Phosphatase Prostate, ACPP)
P9054-67H 1 mg

Prostatic Acid Phosphatase (PAP, Acid Phosphatase Prostate, ACPP)

Sign In for Pricing
View Details
DDB1 polyclonal antibody
BS6999-01 50 µL

DDB1 polyclonal antibody

Sign In for Pricing
View Details
DDB1 polyclonal antibody
BS6999-02 100 µL

DDB1 polyclonal antibody

Sign In for Pricing
View Details
Alpha4Gn-T Polyclonal Antibody
JOT-AP09767-01 20 µL

Alpha4Gn-T Polyclonal Antibody

Sign In for Pricing
View Details
Alpha4Gn-T Polyclonal Antibody
JOT-AP09767-02 50 μL

Alpha4Gn-T Polyclonal Antibody

Sign In for Pricing
View Details
Alpha4Gn-T Polyclonal Antibody
JOT-AP09767-03 100 µL

Alpha4Gn-T Polyclonal Antibody

Sign In for Pricing
View Details