Mouse Il1f10 protein
This Mouse Il1f10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Il1f10Interleukin-1 family member 10, IL-1F10
UniProt
Q8R459
Expression Region
1-152aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6XHis-B2M-tagged: N-terminal 6XHis-SUMO-tagged1-493AA: 1-152AAFull Length: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15227312 1 Vial
Lentiviral mouse Cmc1 shRNA (UAS) - Lentiviral mouseCmc1 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details orb2481510 100 µL
LLPH/C12orf31 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details 
GTR15181217 1 Vial
Lentiviral mouse Rpl39 shRNA (UAS) - Lentiviral mouse Rpl39 shRNA (UAS) (25)
Sign In for Pricing
View Details T8050-11G-ML650 100 µL
TLR2 (Toll Like Receptor 2, Toll-like Receptor 2 Precursor, TLR 2, TLR-2, CD282, CD282 Antigen, Toll/interleukin 1 Receptor-like 4, Toll/interleukin Receptor-like Protein 4, TIL4) (MaxLight 650) discontinued
Sign In for Pricing
View Details