Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il1f10 protein

This Mouse Il1f10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il1f10Interleukin-1 family member 10, IL-1F10

UniProt

Q8R459

Expression Region

1-152aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6XHis-B2M-tagged: N-terminal 6XHis-SUMO-tagged1-493AA: 1-152AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG7 Knockout MES-OV Polyclonal Cells
ARG24265 1 Million

ATG7 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
PLV3-CMV-CKS2-3xFLAG-CopGFP-Puro Plasmid
PVT64979 2 µg

PLV3-CMV-CKS2-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
TCF7L1 Protein Vector (Human) (pPB-N-His)
PV135191 500 ng

TCF7L1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
2- (2-Bromophenyl) ethanol
263267-01 2 g

2- (2-Bromophenyl) ethanol

Sign In for Pricing
View Details
2- (2-Bromophenyl) ethanol
263267-02 5 g

2- (2-Bromophenyl) ethanol

Sign In for Pricing
View Details
2- (2-Bromophenyl) ethanol
263267-03 10 g

2- (2-Bromophenyl) ethanol

Sign In for Pricing
View Details