Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il1f10 protein

This Mouse Il1f10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il1f10Interleukin-1 family member 10, IL-1F10

UniProt

Q8R459

Expression Region

1-152aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6XHis-B2M-tagged: N-terminal 6XHis-SUMO-tagged1-493AA: 1-152AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 650)
MBS6413810-01 0.1 mL

DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 650)

Sign In for Pricing
View Details
DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 650)
MBS6413810-02 5x 0.1 mL

DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 650)

Sign In for Pricing
View Details
Chad Mouse Pre-designed siRNA Set A
HY-RS18029 1 Set

Chad Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
DRAK1 antibody
orb74056 100 µL

DRAK1 antibody

Sign In for Pricing
View Details
TCR, gamma, delta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (Biotin)
MBS6249342-01 0.1 mL

TCR, gamma, delta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (Biotin)

Sign In for Pricing
View Details
TCR, gamma, delta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (Biotin)
MBS6249342-02 5x 0.1 mL

TCR, gamma, delta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (Biotin)

Sign In for Pricing
View Details