Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human cDNA FLJ56323 protein

This Human cDNA FLJ56323 protein spans the amino acid sequence from region 4-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

B4DEE8

Expression Region

4-238aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-246AA: 4-238AAFull Length: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-02 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-04 0.1 mg (Yeast)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)
MBS1017646-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O7:K1 Arginine deiminase (arcA)

Sign In for Pricing
View Details