What is the catalog number for Fungi DOG1 protein?

The catalog number for Fungi DOG1 protein is orb54164.

What sizes are available for Fungi DOG1 protein?

Fungi DOG1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Fungi DOG1 protein come in?

Fungi DOG1 protein is available in 3 different pack sizes.

Is Fungi DOG1 protein in stock?

Fungi DOG1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Fungi DOG1 protein

This Fungi DOG1 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOG1, YHR044C2-deoxyglucose-6-phosphate phosphatase 1, 2-DOG-6-P 1, 2-deoxyglucose-6-phosphatase 1, EC 3.1.3.68

UniProt

P38774

Expression Region

1-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged37-193AA: 1-246AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA