Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi DOG1 protein

This Fungi DOG1 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOG1, YHR044C2-deoxyglucose-6-phosphate phosphatase 1, 2-DOG-6-P 1, 2-deoxyglucose-6-phosphatase 1, EC 3.1.3.68

UniProt

P38774

Expression Region

1-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged37-193AA: 1-246AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr116 AAV siRNA Pooled Vector
22490164 1.0 µg

Gpr116 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
BPY2C sgRNA CRISPR Lentivector (Human) (Target 2)
K0193003 1.0 µg DNA

BPY2C sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Goat anti-PHOX2B Antibody
MBS421704-01 0.1 mg

Goat anti-PHOX2B Antibody

Sign In for Pricing
View Details
Goat anti-PHOX2B Antibody
MBS421704-02 5x 0.1 mg

Goat anti-PHOX2B Antibody

Sign In for Pricing
View Details
CD27L siRNA (h)
sc-42764 10 µM

CD27L siRNA (h)

Sign In for Pricing
View Details
RASAL2 Rabbit Polyclonal Antibody (PE)
orb2589811 100 µg

RASAL2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details