Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Anemonia sulcata Delta-actitoxin-Avd1c protein

This Animal Anemonia sulcata Delta-actitoxin-Avd1c protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATX-II

UniProt

P01528

Expression Region

1-47aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Anemonia sulcata (Mediterranean snakelocks sea anemone)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-57AA: 1-47AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone: femur, head
CS702404 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-,  15nm
GP-2401-15 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-, 15nm

Sign In for Pricing
View Details
DLK-1 Recombinant Rabbit monoclonal Antibody
HA750970 100 µL

DLK-1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Protocadherin 23 (DCHS2) Human Gene Knockout Kit (CRISPR)
KN418874 1 Kit

Protocadherin 23 (DCHS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Syntaxin 4 (STX4) Rabbit Monoclonal Antibody [Clone ID: R07-1G2]
TA385357 100 µL

Syntaxin 4 (STX4) Rabbit Monoclonal Antibody [Clone ID: R07-1G2]

Sign In for Pricing
View Details
ADAM9 Human qPCR Primer Pair (NM_003816)
HP225790 200 Reactions

ADAM9 Human qPCR Primer Pair (NM_003816)

Sign In for Pricing
View Details