Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Anemonia sulcata Delta-actitoxin-Avd1c protein

This Animal Anemonia sulcata Delta-actitoxin-Avd1c protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATX-II

UniProt

P01528

Expression Region

1-47aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Anemonia sulcata (Mediterranean snakelocks sea anemone)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-57AA: 1-47AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NadD Antibody
orb822250 2 mg

NadD Antibody

Sign In for Pricing
View Details
(2-Nitrobenzyl) triphenylphosphonium bromide monohydrate
sc-275081 2 g

(2-Nitrobenzyl) triphenylphosphonium bromide monohydrate

Sign In for Pricing
View Details
SLC25A13 siRNA (Mouse)
MBS8228140-01 15 nmol

SLC25A13 siRNA (Mouse)

Sign In for Pricing
View Details
SLC25A13 siRNA (Mouse)
MBS8228140-02 30 nmol

SLC25A13 siRNA (Mouse)

Sign In for Pricing
View Details
SLC25A13 siRNA (Mouse)
MBS8228140-03 5x 30 nmol

SLC25A13 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial (AIM34)
MBS1168866 Inquire

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial (AIM34)

Sign In for Pricing
View Details