Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal TNF protein

Recombinant animal TNF protein

Product Specifications

Product Name Alternative

(Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a)

UniProt

O35734

Expression Region

57-233aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Marmota monax (Woodchuck)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged: N-terminal 6xHis-B2M-tagged26-344AA: 57-233AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP-L12 Lentiviral Activation Particles (h2)
sc-405871-LAC-2 200 µL

MRP-L12 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TPD52L2 Antibody : FITC (OAAF02021-FITC)
OAAF02021-100UG-FITC 100 µg

TPD52L2 Antibody : FITC (OAAF02021-FITC)

Sign In for Pricing
View Details
RAB8B Rabbit Polyclonal Antibody (Cy5.5)
orb1042575 100 µL

RAB8B Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PTGER2 Overexpression Lysate (Denatured) - (Dry Ice)
H00005732-T01 0.1 mL

PTGER2 Overexpression Lysate (Denatured) - (Dry Ice)

Sign In for Pricing
View Details
SIRP Alpha/SIRPA Rabbit Polyclonal Antibody (Fluoro488)
orb3128219 100 µg

SIRP Alpha/SIRPA Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Slc17a8 Pre-designed siRNA Set B
SI113035B 1 Each

Mouse Slc17a8 Pre-designed siRNA Set B

Sign In for Pricing
View Details