Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 57-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name, TNF-a

UniProt

P06804

Expression Region

57-235aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-338AA: 57-235AAFull Length: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2B Monoclonal Antibody, Cy3 Conjugated
bsm-33174M-Cy3 100 µL

Histone H2B Monoclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
ISO20560PM-115X90-LUCHT Pipe Markers for Air & Ducts
316445 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-115X90-LUCHT Pipe Markers for Air & Ducts

Sign In for Pricing
View Details
TSPY8 CRISPR Activation Plasmid (h)
sc-416343-ACT 20 µg

TSPY8 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Cytochrome P450 Reductase
E8ET7107-35 100 µL

Cytochrome P450 Reductase

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Acylphosphatase 1, Erythrocyte (ACYP1)
MBS2094358-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Acylphosphatase 1, Erythrocyte (ACYP1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Acylphosphatase 1, Erythrocyte (ACYP1)
MBS2094358-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Acylphosphatase 1, Erythrocyte (ACYP1)

Sign In for Pricing
View Details