Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TM4SF1 protein

This Human TM4SF1 protein spans the amino acid sequence from region 115-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6

UniProt

P30408

Expression Region

115-161aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged397-806AA: 115-161AAPartial: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPP1CC qPCR Primer Pair
QH20565S 200 Tests

Human PPP1CC qPCR Primer Pair

Sign In for Pricing
View Details
ACSM5 (NM_017888) Human Over-expression Lysate
LS054988 100 µg

ACSM5 (NM_017888) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFV3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1413704 1.0 µg DNA

NDUFV3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal GNG13 Antibody [DyLight 550]
NBP3-00086R 0.1 mL

Rabbit Polyclonal GNG13 Antibody [DyLight 550]

Sign In for Pricing
View Details
Anti-PAI1/Serpine1 Antibody Picoband® (Dylight550 Conjugate)
A00637-2-Dylight550 100 µg

Anti-PAI1/Serpine1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
4-Amino-3-bromo-5-nitrobenzenesulfonamide
OR1066025-01 100 mg

4-Amino-3-bromo-5-nitrobenzenesulfonamide

Sign In for Pricing
View Details