Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TM4SF1 protein

This Human TM4SF1 protein spans the amino acid sequence from region 115-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6

UniProt

P30408

Expression Region

115-161aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged397-806AA: 115-161AAPartial: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAI24 Protein Vector (Human) (pPM-C-HA)
PV139048 500 ng

TRNAI24 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal NMDAR2A Antibody (S327-95) [Alexa Fluor 405]
NBP2-22405AF405 0.1 mL

Mouse Monoclonal NMDAR2A Antibody (S327-95) [Alexa Fluor 405]

Sign In for Pricing
View Details
OR2T10 (NM_001004693) Human Tagged ORF Clone Lentiviral Particle
RC222525L4V 200 µL

OR2T10 (NM_001004693) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OR52T1P 3'UTR Lenti-reporter-Luc Vector
35356081 1.0 µg

OR52T1P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rhomboid-Related Protein 2 (RHBDL2) Antibody
abx110186-01 20 µL

Rhomboid-Related Protein 2 (RHBDL2) Antibody

Sign In for Pricing
View Details
Rhomboid-Related Protein 2 (RHBDL2) Antibody
abx110186-02 50 µL

Rhomboid-Related Protein 2 (RHBDL2) Antibody

Sign In for Pricing
View Details