Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFR3 protein

This Human FGFR3 protein spans the amino acid sequence from region 397-806aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD333

UniProt

P22607

Expression Region

397-806aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-429AA: 397-806AAFull Length: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GRM4 sgRNA gene knockout kit - Lentiviral human GRM4 sgRNA gene knockout kit (100)
GTR15378529 1 Vial

Lentiviral human GRM4 sgRNA gene knockout kit - Lentiviral human GRM4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (HRP)
MBS6499070-01 0.2 mL

SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (HRP)

Sign In for Pricing
View Details
SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (HRP)
MBS6499070-02 5x 0.2 mL

SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (HRP)

Sign In for Pricing
View Details
Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit
MBS7202623-01 48 Well

Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit

Sign In for Pricing
View Details
Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit
MBS7202623-02 96 Well

Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit

Sign In for Pricing
View Details
Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit
MBS7202623-03 5x 96 Well

Chicken CXXC-type zinc finger protein 5 (CXXC5) ELISA Kit

Sign In for Pricing
View Details