Human LECT1 protein
This Human LECT1 protein spans the amino acid sequence from region 215-334aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cleaved into the following 2 chains, Chondrosurfactant protein Short name, CH-SP Chondromodulin-1 Alternative name (s), Chondromodulin-I Short name, ChM-I
UniProt
O75829
Expression Region
215-334aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged22-176AA: 215-334AAFull Length: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7915-08 10 Blots
CREB, phosphorylated (Ser129, Ser133) (cAMP Response Element Binding Protein)
Sign In for Pricing
View Details 
MBS6272084-01 0.2 mL
AFF2, ID (AFF2, FMR2, OX19, AF4/FMR2 family member 2, Fragile X E mental retardation syndrome protein, Fragile X mental retardation 2 protein, Protein Ox19) (Azide free) (HRP)
Sign In for Pricing
View Details