Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ms4a1 protein

This Mouse Ms4a1 protein spans the amino acid sequence from region 111-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20

UniProt

P19437

Expression Region

111-291aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged141-297AA: 111-291AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAPP1 Antibody, FITC conjugated
CSB-PA892478LC01HU-01 50 μL

DAPP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
DAPP1 Antibody, FITC conjugated
CSB-PA892478LC01HU-02 100 µL

DAPP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human Midkine Alexa Fluor 488 MAb (Clone 2284A)
IC2581G-100UG 100 µg

Human Midkine Alexa Fluor 488 MAb (Clone 2284A)

Sign In for Pricing
View Details
Rabbit anti-ZO-2 Antibody, Affinity Purified
MBS3903999-01 0.01 mg

Rabbit anti-ZO-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZO-2 Antibody, Affinity Purified
MBS3903999-02 0.1 mg

Rabbit anti-ZO-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZO-2 Antibody, Affinity Purified
MBS3903999-03 5x 0.01 mg

Rabbit anti-ZO-2 Antibody, Affinity Purified

Sign In for Pricing
View Details