Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KRT10 protein

This Human KRT10 protein spans the amino acid sequence from region 326-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokeratin-10 , CK-10Keratin-10 , K10

UniProt

P13645

Expression Region

326-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged2-530AA: 326-443AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Belnacasan (VX-765)
MBS578663 Inquire

Belnacasan (VX-765)

Sign In for Pricing
View Details
Cux2 Rabbit pAb, PE-Cy7 conjugated
orb2861936 100 µL

Cux2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
STK25 (Serine/threonine-protein Kinase 25, Ste20-like Kinase, Sterile 20/oxidant Stress-response Kinase 1, SOK-1, Ste20/oxidant Stress Response Kinase 1, SOK1, YSK1)
133978 100 µg

STK25 (Serine/threonine-protein Kinase 25, Ste20-like Kinase, Sterile 20/oxidant Stress-response Kinase 1, SOK-1, Ste20/oxidant Stress Response Kinase 1, SOK1, YSK1)

Sign In for Pricing
View Details
Recombinant Mouse CSF2/GM-CSF Protein, N-His
orb2832115-01 20 µg

Recombinant Mouse CSF2/GM-CSF Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CSF2/GM-CSF Protein, N-His
orb2832115-02 50 µg

Recombinant Mouse CSF2/GM-CSF Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CSF2/GM-CSF Protein, N-His
orb2832115-03 100 µg

Recombinant Mouse CSF2/GM-CSF Protein, N-His

Sign In for Pricing
View Details