Human KRT10 protein
This Human KRT10 protein spans the amino acid sequence from region 326-443aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytokeratin-10 , CK-10Keratin-10 , K10
UniProt
P13645
Expression Region
326-443aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-tagged: N-terminal 6xHis-tagged2-530AA: 326-443AAPartial: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2541930 100 µL
Presenilin 1 + 2 Rabbit Polyclonal Antibody (APC-Cy7)
Sign In for Pricing
View Details 
590641-01 20 µg
ABL1/c-Abl, Recombinant, Human, His-Tag discontinued
Sign In for Pricing
View Details 590641-02 100 µg
ABL1/c-Abl, Recombinant, Human, His-Tag discontinued
Sign In for Pricing
View Details orb74165 100 µL
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa antibody
Sign In for Pricing
View Details 
044029-HRP 200 µL
ZCCHC17, ID (ZCCHC17, PS1D, Nucleolar protein of 40kD, Pnn-interacting nucleolar protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details