Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Il18 protein

This Rat Il18 protein spans the amino acid sequence from region 37-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor , IFN-gamma-inducing factorInterleukin-1 gamma , IL-1 gamma

UniProt

P97636

Expression Region

37-194aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged31-183AA: 37-194AAPartial: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0465608 1.0 µg DNA

CLIP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-Vinculin Antibody
MBS4510074-01 0.05 mL

Rabbit anti-Vinculin Antibody

Sign In for Pricing
View Details
Rabbit anti-Vinculin Antibody
MBS4510074-02 0.1 mL

Rabbit anti-Vinculin Antibody

Sign In for Pricing
View Details
Rabbit anti-Vinculin Antibody
MBS4510074-03 5x 0.1 mL

Rabbit anti-Vinculin Antibody

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
orb1461338-01 20 µg

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
orb1461338-02 100 µg

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details