Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Il18 protein

This Rat Il18 protein spans the amino acid sequence from region 37-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor , IFN-gamma-inducing factorInterleukin-1 gamma , IL-1 gamma

UniProt

P97636

Expression Region

37-194aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged31-183AA: 37-194AAPartial: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (Myc Proto-oncogene Protein, Proto-oncogene c-Myc, Class E Basic Helix-loop-helix Protein 39, bHLHe39, MRTL, Transcription Factor p64) (Biotin) discontinued
C0035-21C 250 µg

C-Myc (Myc Proto-oncogene Protein, Proto-oncogene c-Myc, Class E Basic Helix-loop-helix Protein 39, bHLHe39, MRTL, Transcription Factor p64) (Biotin) discontinued

Sign In for Pricing
View Details
SIP1 Rabbit Polyclonal Antibody (RBITC)
orb1035741 100 µL

SIP1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Human ELK2AP qPCR Primer Pair
QH13697S 200 Tests

Human ELK2AP qPCR Primer Pair

Sign In for Pricing
View Details
SMAP1 HDR Plasmid (m)
sc-430207-HDR 20 µg

SMAP1 HDR Plasmid (m)

Sign In for Pricing
View Details
Mouse Pulmonary Artery Smooth Muscle Cell Medium
ARM0429 500 mL

Mouse Pulmonary Artery Smooth Muscle Cell Medium

Sign In for Pricing
View Details
Recombinant Human IL-18 R beta/IL-1 R7 Fc Avi Protein CF
AVI118-050 50 µg

Recombinant Human IL-18 R beta/IL-1 R7 Fc Avi Protein CF

Sign In for Pricing
View Details