Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish sod1 protein

This Zebrafish sod1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sod1, cuzn, Superoxide dismutase [Cu-Zn], EC 1.15.1.1

UniProt

O73872

Expression Region

1-154aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-154aaSequence Info: Full Length Glycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse Sepiapterin Reductase (SPR) Polyclonal Antibody
VD4N9 1 Each

Rabbit Anti-Mouse Sepiapterin Reductase (SPR) Polyclonal Antibody

Sign In for Pricing
View Details
PCDNA3.1-CMV-GST-PARK7 (human)
BZ31764 1 Vial

PCDNA3.1-CMV-GST-PARK7 (human)

Sign In for Pricing
View Details
AZDye594 NT Labeling Kit
orb2702591 50 Reactions

AZDye594 NT Labeling Kit

Sign In for Pricing
View Details
Goat selenoprotein 1 (SEP1) ELISA Kit
MBS2615038-01 48 Well

Goat selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details
Goat selenoprotein 1 (SEP1) ELISA Kit
MBS2615038-02 96 Well

Goat selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details
Goat selenoprotein 1 (SEP1) ELISA Kit
MBS2615038-03 5x 96 Well

Goat selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details