Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sult1a1 protein

This Rat Sult1a1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase Aryl sulfotransferase IV

UniProt

P17988

Expression Region

1-291aa

Tag

N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELFE Polyclonal Antibody
orb617979-01 50 μL

NELFE Polyclonal Antibody

Sign In for Pricing
View Details
NELFE Polyclonal Antibody
orb617979-02 100 µL

NELFE Polyclonal Antibody

Sign In for Pricing
View Details
Mouse UTRN ELISA Kit (Ready to Use)
orb554251-01 48 Tests

Mouse UTRN ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse UTRN ELISA Kit (Ready to Use)
orb554251-02 96 Tests

Mouse UTRN ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
mmu-miR-7236-3p miRNA Inhibitor
MIM03042 2x 5.0 nmol

mmu-miR-7236-3p miRNA Inhibitor

Sign In for Pricing
View Details
KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (Biotin) discontinued
037322-Biotin 200 µL

KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (Biotin) discontinued

Sign In for Pricing
View Details