Rat Sult1a1 protein
This Rat Sult1a1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Aryl sulfotransferase Aryl sulfotransferase IV
UniProt
P17988
Expression Region
1-291aa
Tag
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
53.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full LengthGlycerol content: 0.5
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6235708-01 0.1 mL
TCF2 (Hepatocyte Nuclear Factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription Factor 2, TCF-2, Variant Hepatic Nuclear Factor 1, vHNF1, HNF1B) (MaxLight 750)
Sign In for Pricing
View Details MBS6235708-02 5x 0.1 mL
TCF2 (Hepatocyte Nuclear Factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription Factor 2, TCF-2, Variant Hepatic Nuclear Factor 1, vHNF1, HNF1B) (MaxLight 750)
Sign In for Pricing
View Details 
GTR15130207 1 Vial
Lentiviral human USP44 shRNA (UAS) - Lentiviral human USP44 shRNA (UAS) plasmid
Sign In for Pricing
View Details