Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DRB1 protein

This Human HLA-DRB1 protein spans the amino acid sequence from region 30-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class II antigen DRB1*1

UniProt

P04229

Expression Region

30-227aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 30-227aaSequence Info: Extracellular DomainGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP3P1 Adenovirus (Human)
15072051 1.0 mL

CASP3P1 Adenovirus (Human)

Sign In for Pricing
View Details
IF3EI Polyclonal Antibody, PE Conjugated
bs-15527R-PE 100 µL

IF3EI Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
SH-PTP1 Polyclonal Antibody
RA29814-01 50 µL

SH-PTP1 Polyclonal Antibody

Sign In for Pricing
View Details
SH-PTP1 Polyclonal Antibody
RA29814-02 100 µL

SH-PTP1 Polyclonal Antibody

Sign In for Pricing
View Details
Human CDC34 qPCR Primer Pair
QH01893S 200 Tests

Human CDC34 qPCR Primer Pair

Sign In for Pricing
View Details
BSCL2 AAV Vector (Human) (CMV)
13501101 1 µg

BSCL2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details