Human HLA-DRB1 protein
This Human HLA-DRB1 protein spans the amino acid sequence from region 30-227aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MHC class II antigen DRB1*1
UniProt
P04229
Expression Region
30-227aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 30-227aaSequence Info: Extracellular DomainGlycerol content: 0.5
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
CK-bio-10536-01 48 Tests
Human ATPase, Ca++ Transporting, Plasma Membrane 2 (ATP2B2) ELISA kit
Sign In for Pricing
View Details CK-bio-10536-02 96 Tests
Human ATPase, Ca++ Transporting, Plasma Membrane 2 (ATP2B2) ELISA kit
Sign In for Pricing
View Details 
CK-bio-10536-03 5x 96 Tests
Human ATPase, Ca++ Transporting, Plasma Membrane 2 (ATP2B2) ELISA kit
Sign In for Pricing
View Details CK-bio-10536-04 10x 96 Tests
Human ATPase, Ca++ Transporting, Plasma Membrane 2 (ATP2B2) ELISA kit
Sign In for Pricing
View Details