Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DRB1 protein

This Human HLA-DRB1 protein spans the amino acid sequence from region 30-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class II antigen DRB1*1

UniProt

P04229

Expression Region

30-227aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 30-227aaSequence Info: Extracellular DomainGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNFN1A3 (IKAROS Family Zinc Finger 3 (Aiolos), AIO, AIOLOS, ZNFN1A3) (MaxLight 650)
MBS6230779-01 0.1 mL

ZNFN1A3 (IKAROS Family Zinc Finger 3 (Aiolos), AIO, AIOLOS, ZNFN1A3) (MaxLight 650)

Sign In for Pricing
View Details
ZNFN1A3 (IKAROS Family Zinc Finger 3 (Aiolos), AIO, AIOLOS, ZNFN1A3) (MaxLight 650)
MBS6230779-02 5x 0.1 mL

ZNFN1A3 (IKAROS Family Zinc Finger 3 (Aiolos), AIO, AIOLOS, ZNFN1A3) (MaxLight 650)

Sign In for Pricing
View Details
AMYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV757290 1.0 µg DNA

AMYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Plac1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3541407 1.0 µg DNA

Plac1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ntrk3 Rat siRNA Oligo Duplex (Locus ID 29613)
SR514934 1 Kit

Ntrk3 Rat siRNA Oligo Duplex (Locus ID 29613)

Sign In for Pricing
View Details
Recombinant Human Siglec-9 Fc Chimera CF
1139-SL-050 50 µg

Recombinant Human Siglec-9 Fc Chimera CF

Sign In for Pricing
View Details