Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial omcB protein

This Bacterial omcB protein spans the amino acid sequence from region 41-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large-CRP Alternative name (s), 60KDA cysteine-rich OMP 60KDA outer membrane protein Cysteine-rich outer membrane protein Short name, CRP

UniProt

P0CC04

Expression Region

41-196aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 41-196aaSequence Info: PartialGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mause anti-Beta-2-Glycoprotein 1 Monoclonal Antibody [7B8]
A500-007A 100 µL (10 Blots)

Mause anti-Beta-2-Glycoprotein 1 Monoclonal Antibody [7B8]

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)
MBS1292902-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)
MBS1292902-02 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)
MBS1292902-03 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)
MBS1292902-04 0.1 mg (Yeast)

Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)
MBS1292902-05 0.02 mg (Baculovirus)

Recombinant Burkholderia pseudomallei Probable allantoicase 1 (alc1)

Sign In for Pricing
View Details