Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Vertebrate ancient opsin protein

This Fish Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vertebrate ancient opsin

UniProt

O13018

Expression Region

1-75aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Salmo salar (Atlantic salmon)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

References & Citations

Choi, Ji Yong et al. Effects of recombinant vertebrate ancient long opsin on reproduction in goldfish, Carassius auratus: profiling green-wavelength light Fish Physiol Biochem, 44, 1027-1036 (2018)

Pubmed id

29542047

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-B2M-taggedExpression Region: 1-75aaSequence Info: Partial Glycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK2, CT (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (APC)
MBS6486848-01 0.2 mL

MARK2, CT (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (APC)

Sign In for Pricing
View Details
MARK2, CT (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (APC)
MBS6486848-02 5x 0.2 mL

MARK2, CT (MAP/microtubule Affinity-regulating Kinase 2, ELKL Motif Kinase 1, EMK1, EMK-1, PAR1 Homolog, PAR1 Homolog b, Par1b, Par-1b, PAR-1, Serine/threonine-protein Kinase MARK2) (APC)

Sign In for Pricing
View Details
COL6A2 (Collagen alpha-2 (VI) Chain) (MaxLight 490)
125189-ML490 100 µL

COL6A2 (Collagen alpha-2 (VI) Chain) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Anti-Monkey IgM Secondary Antibody-FITC
TMAB-02032F-01 100 µL

Rabbit Anti-Monkey IgM Secondary Antibody-FITC

Sign In for Pricing
View Details
Rabbit Anti-Monkey IgM Secondary Antibody-FITC
TMAB-02032F-02 1 mL

Rabbit Anti-Monkey IgM Secondary Antibody-FITC

Sign In for Pricing
View Details
UGT1A1 Human
32-6943-20 20 µg

UGT1A1 Human

Sign In for Pricing
View Details