Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Vertebrate ancient opsin protein

This Fish Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vertebrate ancient opsin

UniProt

O13018

Expression Region

1-75aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Salmo salar (Atlantic salmon)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

References & Citations

Choi, Ji Yong et al. Effects of recombinant vertebrate ancient long opsin on reproduction in goldfish, Carassius auratus: profiling green-wavelength light Fish Physiol Biochem, 44, 1027-1036 (2018)

Pubmed id

29542047

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-B2M-taggedExpression Region: 1-75aaSequence Info: Partial Glycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 Antibody / c-Kit
orb2643922 100 µg

CD117 Antibody / c-Kit

Sign In for Pricing
View Details
Mouse Decorin (DCN) ELISA Kit
orb1817369-01 48 Tests

Mouse Decorin (DCN) ELISA Kit

Sign In for Pricing
View Details
Mouse Decorin (DCN) ELISA Kit
orb1817369-02 96 Tests

Mouse Decorin (DCN) ELISA Kit

Sign In for Pricing
View Details
BRDT Protein Vector (Mouse) (pPM-C-HA)
13471025 500 ng

BRDT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCP-4 Double Nickase Plasmid (m2)
sc-422138-NIC-2 20 µg

PCP-4 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
CYP39A1
CSB-CL882143HU 10 μg Plasmid + 200 μL Glycerol

CYP39A1

Sign In for Pricing
View Details