Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COMT protein

This Human COMT protein spans the amino acid sequence from region 52-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Catechol O methyltransferase, Catechol O-methyltransferase, COMT, COMT_HUMAN, EC 2.1.1.6

UniProt

P21964

Expression Region

52-271aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-taggedExpression Region: 52-271aaSequence Info: PartialGlycerol content: 0.2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHIP (SH-2-containing Inositol 5' Phosphatase) (BSA & Azide Free) discontinued
S1013-20A 200 µg

SHIP (SH-2-containing Inositol 5' Phosphatase) (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Rig, Small GTP-binding Tumor Suppressor 1)
313539-01 50 µL

DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Rig, Small GTP-binding Tumor Suppressor 1)

Sign In for Pricing
View Details
DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Rig, Small GTP-binding Tumor Suppressor 1)
313539-02 100 µL

DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Rig, Small GTP-binding Tumor Suppressor 1)

Sign In for Pricing
View Details
PRKACA, Phosphorylated (Thr197) (cAMP-dependent Protein Kinase Catalytic Subunit alpha, PKA C-alpha, PKACA)
P9103-22Y-01 20 µL

PRKACA, Phosphorylated (Thr197) (cAMP-dependent Protein Kinase Catalytic Subunit alpha, PKA C-alpha, PKACA)

Sign In for Pricing
View Details
PRKACA, Phosphorylated (Thr197) (cAMP-dependent Protein Kinase Catalytic Subunit alpha, PKA C-alpha, PKACA)
P9103-22Y-02 100 µL

PRKACA, Phosphorylated (Thr197) (cAMP-dependent Protein Kinase Catalytic Subunit alpha, PKA C-alpha, PKACA)

Sign In for Pricing
View Details
TUBB6 (Center) Rabbit pAb
MBS8551598-01 0.1 mL

TUBB6 (Center) Rabbit pAb

Sign In for Pricing
View Details