Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COMT protein

This Human COMT protein spans the amino acid sequence from region 52-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Catechol O methyltransferase, Catechol O-methyltransferase, COMT, COMT_HUMAN, EC 2.1.1.6

UniProt

P21964

Expression Region

52-271aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-taggedExpression Region: 52-271aaSequence Info: PartialGlycerol content: 0.2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIF1BP Protein Lysate 20ug
IHUKIF1BPPLLY20UG 20 µg

Human KIF1BP Protein Lysate 20ug

Sign In for Pricing
View Details
GLRX (Glutaredoxin (Thioltransferase), GRX, GRX1, MGC117407) (MaxLight 750)
MBS6238480-01 0.1 mL

GLRX (Glutaredoxin (Thioltransferase), GRX, GRX1, MGC117407) (MaxLight 750)

Sign In for Pricing
View Details
GLRX (Glutaredoxin (Thioltransferase), GRX, GRX1, MGC117407) (MaxLight 750)
MBS6238480-02 5x 0.1 mL

GLRX (Glutaredoxin (Thioltransferase), GRX, GRX1, MGC117407) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Mouse BACE-1 Protein (His tag)
ARP8071-01 10 µg

Recombinant Mouse BACE-1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse BACE-1 Protein (His tag)
ARP8071-02 50 µg

Recombinant Mouse BACE-1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse BACE-1 Protein (His tag)
ARP8071-03 100 µg

Recombinant Mouse BACE-1 Protein (His tag)

Sign In for Pricing
View Details