Human CEACAM8 protein
This Human CEACAM8 protein spans the amino acid sequence from region 35-320aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen, CD66b
UniProt
P31997
Expression Region
35-320aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
47.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-320aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS205118-01 0.02 mg
DLX3, 1- 186aa, Human, His tag, E Coli (Denatured)
Sign In for Pricing
View Details MBS205118-02 0.1 mg
DLX3, 1- 186aa, Human, His tag, E Coli (Denatured)
Sign In for Pricing
View Details MBS205118-03 5x 0.02 mg
DLX3, 1- 186aa, Human, His tag, E Coli (Denatured)
Sign In for Pricing
View Details MBS205118-04 0.5 mg
DLX3, 1- 186aa, Human, His tag, E Coli (Denatured)
Sign In for Pricing
View Details MBS205118-05 5x 0.1 mg
DLX3, 1- 186aa, Human, His tag, E Coli (Denatured)
Sign In for Pricing
View Details