Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM3 protein

This Human CEACAM3 protein spans the amino acid sequence from region 35-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM1 CD_antigen, CD66d

UniProt

P40198

Expression Region

35-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-155aaSequence Info: Extracellular DomainGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRIP1 (N-term) rabbit polyclonal antibody, Aff - Purified
AP50391PU-N 400 µL

BRIP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Recombinant human POTGlu protein with C-terminal human Fc tag
32-17351-50 50 µg

Recombinant human POTGlu protein with C-terminal human Fc tag

Sign In for Pricing
View Details
HT-29-C1.27H Cells
T8211 1x106 cells / 1.0 mL

HT-29-C1.27H Cells

Sign In for Pricing
View Details
C18orf56 (TYMSOS) Human Over-expression Lysate
orb1342840 100 µg

C18orf56 (TYMSOS) Human Over-expression Lysate

Sign In for Pricing
View Details
IGKV1-5 Protein Vector (Human) (pPB-C-His)
PV021093 500 ng

IGKV1-5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
DERL2 AAV siRNA Pooled Vector
18038161 1.0 µg

DERL2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details