Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM3 protein

This Human CEACAM3 protein spans the amino acid sequence from region 35-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM1 CD_antigen, CD66d

UniProt

P40198

Expression Region

35-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-155aaSequence Info: Extracellular DomainGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinpyr-4
sc-213183 1 mg

Zinpyr-4

Sign In for Pricing
View Details
QseB Antibody
orb825057 2 mg

QseB Antibody

Sign In for Pricing
View Details
Olr403 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34376156 3x 1.0 µg DNA

Olr403 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Methyl 6-bromo-5-chloropyrazine-2-carboxylate
SQB60387-01 0.05 g

Methyl 6-bromo-5-chloropyrazine-2-carboxylate

Sign In for Pricing
View Details
Methyl 6-bromo-5-chloropyrazine-2-carboxylate
SQB60387-02 0.1 g

Methyl 6-bromo-5-chloropyrazine-2-carboxylate

Sign In for Pricing
View Details
Methyl 6-bromo-5-chloropyrazine-2-carboxylate
SQB60387-03 0.25 g

Methyl 6-bromo-5-chloropyrazine-2-carboxylate

Sign In for Pricing
View Details