Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fuca1 protein

This Mouse Fuca1 protein spans the amino acid sequence from region 18-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-L-fucosidase I Alpha-L-fucoside fucohydrolase 1

UniProt

Q99LJ1

Expression Region

18-452aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 18-452aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAH Antibody - middle region
MBS3223550-01 0.1 mL

PAH Antibody - middle region

Sign In for Pricing
View Details
PAH Antibody - middle region
MBS3223550-02 5x 0.1 mL

PAH Antibody - middle region

Sign In for Pricing
View Details
GRAMD4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
22634061 1.0 µg DNA

GRAMD4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HFL1 Cell Line
CL-0106 1x 10^6 Cells/Vial - 2 Vials

HFL1 Cell Line

Sign In for Pricing
View Details
Anti-Human IgM
IT-000-hIg-M7-HRP 0.05 mg

Anti-Human IgM

Sign In for Pricing
View Details
Human DAB2IP siRNA
abx901402-01 15 nmol

Human DAB2IP siRNA

Sign In for Pricing
View Details