Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mppA protein

This E. coli mppA protein spans the amino acid sequence from region 23-537aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MppA, ynaH, b1329, JW1322, Periplasmic murein peptide-binding protein

UniProt

P77348

Expression Region

23-537aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-537aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Lactoferrin Monoclonal Antibody (Clone:LF5-1D2)
30-1058-0.1 0.1 mg

Anti-Lactoferrin Monoclonal Antibody (Clone:LF5-1D2)

Sign In for Pricing
View Details
LHX9 (NM_020204) Human Tagged Lenti ORF Clone
RC224621L4 10 µg

LHX9 (NM_020204) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CRX 3'UTR Lenti-reporter-Luc Vector
16869081 1.0 µg

CRX 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TSPAN7 antibody
70R-21038 50 μL

TSPAN7 antibody

Sign In for Pricing
View Details
E2F1, Phosphorylated (Ser332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 405)
MBS6473369-01 0.1 mL

E2F1, Phosphorylated (Ser332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 405)

Sign In for Pricing
View Details
E2F1, Phosphorylated (Ser332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 405)
MBS6473369-02 5x 0.1 mL

E2F1, Phosphorylated (Ser332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 405)

Sign In for Pricing
View Details