Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli yebF protein

This E. coli yebF protein spans the amino acid sequence from region 22-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YebF, b1847, JW1836, Protein YebF

UniProt

P33219

Expression Region

22-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 22-118aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HES-1 Antibody (OTI4H1) [Alexa Fluor 750]
NBP2-70937AF750 0.1 mL

Mouse Monoclonal HES-1 Antibody (OTI4H1) [Alexa Fluor 750]

Sign In for Pricing
View Details
Mouse HPRG Biotinylated Affinity Purified PAb
BAF1905 50 µg

Mouse HPRG Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
Primary Cell Protein Transfection Reagent
L3390 0.3 mL

Primary Cell Protein Transfection Reagent

Sign In for Pricing
View Details
Telikibart
HY-P991031 1 Each

Telikibart

Sign In for Pricing
View Details
Recombinant Pinus koraiensis ATP synthase subunit c, chloroplastic (atpH)
orb2936332-01 20 µg

Recombinant Pinus koraiensis ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Recombinant Pinus koraiensis ATP synthase subunit c, chloroplastic (atpH)
orb2936332-02 100 µg

Recombinant Pinus koraiensis ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details