Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli yebF protein

This E. coli yebF protein spans the amino acid sequence from region 22-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YebF, b1847, JW1836, Protein YebF

UniProt

P33219

Expression Region

22-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 22-118aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4SC-203
E0499-25mg 25 mg

4SC-203

Sign In for Pricing
View Details
DPP3 (Dipeptidyl-Peptidase 3, DPPIII, FLJ11387, FLJ22331) (Biotin)
245480-Biotin 100 µL

DPP3 (Dipeptidyl-Peptidase 3, DPPIII, FLJ11387, FLJ22331) (Biotin)

Sign In for Pricing
View Details
MFluor™ Red 780 Anti-mouse/ human CD59 Antibody *MEM-43/5*
105900W1-AAT 500 Tests

MFluor™ Red 780 Anti-mouse/ human CD59 Antibody *MEM-43/5*

Sign In for Pricing
View Details
PPAP2A Adenovirus (Mouse)
37289055 1.0 mL

PPAP2A Adenovirus (Mouse)

Sign In for Pricing
View Details
Sheep Polyclonal anti-human MSP R
hAP-5336 50 µg

Sheep Polyclonal anti-human MSP R

Sign In for Pricing
View Details
DDX27 antibody
10R-1351 100 ug

DDX27 antibody

Sign In for Pricing
View Details