Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Wnt8b protein

This Mouse Wnt8b protein spans the amino acid sequence from region 22-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Wnt8bProtein Wnt-8b

UniProt

Q9WUD6

Expression Region

22-350aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 22-350aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-XYLT1 Antibody
MBS8322904-01 0.03 mL

Anti-XYLT1 Antibody

Sign In for Pricing
View Details
Anti-XYLT1 Antibody
MBS8322904-02 0.05 mL

Anti-XYLT1 Antibody

Sign In for Pricing
View Details
Anti-XYLT1 Antibody
MBS8322904-03 0.1 mL

Anti-XYLT1 Antibody

Sign In for Pricing
View Details
Anti-XYLT1 Antibody
MBS8322904-04 0.2 mL

Anti-XYLT1 Antibody

Sign In for Pricing
View Details
Anti-XYLT1 Antibody
MBS8322904-05 5x 0.2 mL

Anti-XYLT1 Antibody

Sign In for Pricing
View Details
Human IGFL2 Knockout A549 cell line
GTR15401720 1 Vial

Human IGFL2 Knockout A549 cell line

Sign In for Pricing
View Details