Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gzma protein

This Mouse Gzma protein spans the amino acid sequence from region 29-260aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autocrine thymic lymphoma granzyme-like serine protease CTLA-3 Fragmentin-1 T cell-specific serine protease 1

UniProt

P11032

Expression Region

29-260aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-B2M-taggedExpression Region: 29-260aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF640R conjugate, 0.1mg/mL
BNC402156-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF594 conjugate, 0.1mg/mL
BNC942246-100 1x 100 µL

Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-16096-01 20 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-16096-02 60 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-16096-03 120 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-16096-04 200 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details